PPP2R1B anticorps

N° du produit ABIN634654

Détail du produit anti-PPP2R1B anticorps

Antigène: PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP2R1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP2R1B Blocking Peptide, catalog no. 33R-2332, is also available for use as a blocking control in assays to test for specificity of this PPP2R1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP2R1B

Antigène: PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))

Autre désignation: PPP2R1B (PPP2R1B Produits)

Synonymes: anticorps 2410091N08Rik, anticorps AI790395, anticorps PP2A-Abeta, anticorps PR65B, anticorps protein phosphatase 2, regulatory subunit A, beta, anticorps protein phosphatase 2 scaffold subunit Abeta, anticorps protein phosphatase 2 scaffold subunit A beta, anticorps protein phosphatase 2 regulatory subunit A, beta S homeolog, anticorps Ppp2r1b, anticorps PPP2R1B, anticorps ppp2r1b.S

Sujet: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Mitotic G1-G1/S Phases, Hepatitis C, Toll-Like Receptors Cascades