ITGB3BP anticorps

N° du produit ABIN634666

Détail du produit anti-ITGB3BP anticorps

Antigène: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGB3BP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ITGB3 BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITGB3BP Blocking Peptide, catalog no. 33R-9096, is also available for use as a blocking control in assays to test for specificity of this ITGB3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGB3BP

Antigène: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Autre désignation: ITGB3BP (ITGB3BP Produits)

Synonymes: anticorps CENP-R, anticorps CENPR, anticorps HSU37139, anticorps NRIF3, anticorps TAP20, anticorps 4930471O16Rik, anticorps AU022583, anticorps integrin subunit beta 3 binding protein, anticorps integrin beta 3 binding protein (beta3-endonexin), anticorps ITGB3BP, anticorps Itgb3bp

Sujet: ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway