ITGB3BP anticorps

N° du produit ABIN634666

Cet anticorps Lapin Polyclonal détecte spécifiquement ITGB3BP dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ITGB3BP anticorps (ABIN634666)

Antigène: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGB3BP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ITGB3BP anticorps

Purification: Affinity purified

Immunogène: ITGB3 BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITGB3BP Blocking Peptide, (ABIN5614227), is also available for use as a blocking control in assays to test for specificity of this ITGB3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGB3BP

Antigène: ITGB3BP (Integrin beta 3 Binding Protein (Beta3-Endonexin) (ITGB3BP))

Autre désignation: ITGB3BP

Sujet: ITGB3BP is a transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway