Cadherin 8 anticorps (Middle Region)

N° du produit ABIN634700

L’anticorps anti-Cadherin 8 Polyclonal Lapin est utilisé pour la détection de Cadherin 8 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Cadherin 8 anticorps (Middle Region) (ABIN634700)

Antigène: Cadherin 8 (CDH8)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cadherin 8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Cadherin 8 anticorps

Épitope: Middle Region

Specificité: CDH8 antibody was raised against the middle region of CDH8

Purification: Affinity purified

Immunogène: CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH8 Blocking Peptide, (ABIN939107), is also available for use as a blocking control in assays to test for specificity of this CDH8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cadherin 8

Antigène: Cadherin 8 (CDH8)

Autre désignation: CDH8

Sujet: CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization