Cadherin 8 anticorps (Middle Region)
-
- Antigène Voir toutes Cadherin 8 (CDH8) Anticorps
- Cadherin 8 (CDH8)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cadherin 8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CDH8 antibody was raised against the middle region of CDH8
- Purification
- Affinity purified
- Immunogène
- CDH8 antibody was raised using the middle region of CDH8 corresponding to a region with amino acids HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL
- Top Product
- Discover our top product CDH8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDH8 Blocking Peptide, catalog no. 33R-3721, is also available for use as a blocking control in assays to test for specificity of this CDH8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cadherin 8 (CDH8)
- Autre désignation
- CDH8 (CDH8 Produits)
- Synonymes
- anticorps AI851472, anticorps cad8, anticorps cadherin-8, anticorps Nbla04261, anticorps cadherin 8, anticorps cadherin 8, type 2, anticorps Cdh8, anticorps CDH8
- Sujet
- CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain.
- Poids moléculaire
- 81 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-