GJC2 anticorps (Middle Region)

N° du produit ABIN634743

Détail du produit anti-GJC2 anticorps

Antigène: GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJC2 antibody was raised against the middle region of GJC2

Purification: Affinity purified

Immunogène: GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJC2

Antigène: GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))

Autre désignation: GJC2 (GJC2 Produits)

Synonymes: anticorps GJA12, anticorps cx47, anticorps gja12, anticorps cx46.6, anticorps pmldar, anticorps MGC146420, anticorps B230382L12Rik, anticorps Cx47, anticorps Gja12, anticorps CX46.6, anticorps HLD2, anticorps LMPH1C, anticorps PMLDAR, anticorps SPG44, anticorps gap junction protein gamma 2, anticorps si:dkey-91f15.1, anticorps gap junction protein, gamma 2, anticorps GJC2, anticorps gjc2, anticorps si:dkey-91f15.1, anticorps Gjc2

Sujet: GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.

Poids moléculaire: 47 kDa (MW of target protein)