GJC2 anticorps (Middle Region)
-
- Antigène Voir toutes GJC2 Anticorps
- GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GJC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GJC2 antibody was raised against the middle region of GJC2
- Purification
- Affinity purified
- Immunogène
- GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
- Top Product
- Discover our top product GJC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GJC2 (Gap Junction Protein, gamma 2, 47kDa (GJC2))
- Autre désignation
- GJC2 (GJC2 Produits)
- Synonymes
- anticorps GJA12, anticorps cx47, anticorps gja12, anticorps cx46.6, anticorps pmldar, anticorps MGC146420, anticorps B230382L12Rik, anticorps Cx47, anticorps Gja12, anticorps CX46.6, anticorps HLD2, anticorps LMPH1C, anticorps PMLDAR, anticorps SPG44, anticorps gap junction protein gamma 2, anticorps si:dkey-91f15.1, anticorps gap junction protein, gamma 2, anticorps GJC2, anticorps gjc2, anticorps si:dkey-91f15.1, anticorps Gjc2
- Sujet
- GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.
- Poids moléculaire
- 47 kDa (MW of target protein)
-