LYVE1 anticorps (N-Term)

N° du produit ABIN634754

Détail du produit anti-LYVE1 anticorps

Antigène: LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYVE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYVE1 antibody was raised against the N terminal of LYVE1

Purification: Affinity purified

Immunogène: LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYVE1 Blocking Peptide, catalog no. 33R-1461, is also available for use as a blocking control in assays to test for specificity of this LYVE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYVE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-LYVE1 (ABIN634754)

Yücel, Johnston, Ly, Patel, Drake, Gümüş, Fraenkl, Moore, Tobbia, Armstrong, Horvath, Gupta: "Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." dans: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).

Détails sur LYVE1

Antigène: LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))

Autre désignation: LYVE1 (LYVE1 Produits)

Synonymes: anticorps LYVE1, anticorps XLKD1, anticorps CRSBP-1, anticorps HAR, anticorps LYVE-1, anticorps 1200012G08Rik, anticorps Crsbp-1, anticorps Lyve-1, anticorps Xlkd1, anticorps lymphatic vessel endothelial hyaluronic receptor 1a, anticorps lymphatic vessel endothelial hyaluronan receptor 1, anticorps lyve1a, anticorps LYVE1, anticorps Lyve1

Sujet: LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process