Cadherin 4 anticorps

N° du produit ABIN634765

Détail du produit anti-Cadherin 4 anticorps

Antigène: Cadherin 4 (CDH4)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cadherin 4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSRGPFPQQLVRIRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH4 Blocking Peptide, catalog no. 33R-2616, is also available for use as a blocking control in assays to test for specificity of this CDH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cadherin 4

Antigène: Cadherin 4 (CDH4)

Autre désignation: CDH4 (CDH4 Produits)

Synonymes: anticorps cad4, anticorps rcad, anticorps R-cadherin, anticorps cadherin-4, anticorps AW120700, anticorps R-Cadh, anticorps Rcad, anticorps Cdh4l, anticorps zgc:136316, anticorps CAD4, anticorps RCAD, anticorps cadherin 4, anticorps cadherin 4, type 1, R-cadherin (retinal), anticorps Cadherin-4, anticorps cdh4, anticorps Cdh4, anticorps CDH4, anticorps cdh-4

Sujet: CDH4 gene is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization.

Poids moléculaire: 82 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Regulation of Cell Size