GDF2 anticorps (Middle Region)
-
- Antigène Voir toutes GDF2 Anticorps
- GDF2 (Growth Differentiation Factor 2 (GDF2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GDF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GDF2 antibody was raised against the middle region of GDF2
- Purification
- Affinity purified
- Immunogène
- GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM
- Top Product
- Discover our top product GDF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GDF2 Blocking Peptide, catalog no. 33R-1682, is also available for use as a blocking control in assays to test for specificity of this GDF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GDF2 (Growth Differentiation Factor 2 (GDF2))
- Autre désignation
- GDF2 (GDF2 Produits)
- Synonymes
- anticorps bmp9, anticorps BMP-9, anticorps BMP9, anticorps Bmp9, anticorps DSL1, anticorps growth differentiation factor 2, anticorps gdf2, anticorps GDF2, anticorps Gdf2
- Sujet
- GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-