LIF anticorps

N° du produit ABIN634803

Détail du produit anti-LIF anticorps

Antigène: LIF (Leukemia Inhibitory Factor (LIF))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIF est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LIF antibody was raised using a synthetic peptide corresponding to a region with amino acids KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIF Blocking Peptide, catalog no. 33R-4712, is also available for use as a blocking control in assays to test for specificity of this LIF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIF

Antigène: LIF (Leukemia Inhibitory Factor (LIF))

Autre désignation: LIF (LIF Produits)

Synonymes: anticorps CDF, anticorps DIA, anticorps HILDA, anticorps MLPLI, anticorps LIF, interleukin 6 family cytokine, anticorps leukemia inhibitory factor, anticorps LIF, anticorps Lif

Sujet: LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Positive Regulation of Peptide Hormone Secretion, Negative Regulation of Hormone Secretion, Stem Cell Maintenance, Growth Factor Binding