SLC39A10 anticorps

N° du produit ABIN634830

Détail du produit anti-SLC39A10 anticorps

Antigène: SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC39 A10 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A10 Blocking Peptide, catalog no. 33R-5026, is also available for use as a blocking control in assays to test for specificity of this SLC39A10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A10

Antigène: SLC39A10 (Solute Carrier Family 39 (Zinc Transporter), Member 10 (SLC39A10))

Autre désignation: SLC39A10 (SLC39A10 Produits)

Synonymes: anticorps LZT-Hs2, anticorps 2900042E17Rik, anticorps 5430433I10, anticorps mKIAA1265, anticorps Slc39a10, anticorps Zip10, anticorps zgc:63552, anticorps DKFZp459C165, anticorps solute carrier family 39 member 10, anticorps solute carrier family 39 (zinc transporter), member 10, anticorps solute carrier family 39 (zinc transporter), member 4-like, anticorps SLC39A10, anticorps Slc39a10, anticorps Slc39a4l, anticorps slc39a10

Sujet: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A10 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation.

Poids moléculaire: 94 kDa (MW of target protein)