PDE3B anticorps (Middle Region)
-
- Antigène Voir toutes PDE3B Anticorps
- PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDE3B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDE3 B antibody was raised against the middle region of PDE3
- Purification
- Affinity purified
- Immunogène
- PDE3 B antibody was raised using the middle region of PDE3 corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
- Top Product
- Discover our top product PDE3B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDE3B Blocking Peptide, catalog no. 33R-8765, is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDE3B (phosphodiesterase 3B, CGMP-Inhibited (PDE3B))
- Autre désignation
- PDE3B (PDE3B Produits)
- Synonymes
- anticorps PDE3B, anticorps HcGIP1, anticorps cGIPDE1, anticorps 9830102A01Rik, anticorps AI847709, anticorps phosphodiesterase 3B, anticorps phosphodiesterase 3B, cGMP-inhibited, anticorps si:ch211-79e4.4, anticorps phosphodiesterase 3B L homeolog, anticorps PDE3B, anticorps pde3b, anticorps Pde3b, anticorps si:ch211-79e4.4, anticorps pde3b.L
- Sujet
- PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.
- Poids moléculaire
- 124 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, cAMP Metabolic Process
-