KCC2 anticorps

N° du produit ABIN634866

Cet anticorps anti-KCC2 Polyclonal Lapin (ABIN634866) détecte spécifiquement KCC2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour KCC2 anticorps (ABIN634866)

Antigène: KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCC2 anticorps

Purification: Affinity purified

Immunogène: SLC12 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC12A5 Blocking Peptide, (ABIN5616177), is also available for use as a blocking control in assays to test for specificity of this SLC12A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCC2

Antigène: KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))

Autre désignation: SLC12A5

Sujet: K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential.

Poids moléculaire: 123 kDa (MW of target protein)