KCC2 anticorps
-
- Antigène Voir toutes KCC2 (SLC12A5) Anticorps
- KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC12 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG
- Top Product
- Discover our top product SLC12A5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC12A5 Blocking Peptide, catalog no. 33R-9750, is also available for use as a blocking control in assays to test for specificity of this SLC12A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCC2 (SLC12A5) (Solute Carrier Family 12 (Potassium-Chloride Transporter) Member 5 (SLC12A5))
- Autre désignation
- SLC12A5 (SLC12A5 Produits)
- Synonymes
- anticorps Kcc2, anticorps KCC2, anticorps mKIAA1176, anticorps solute carrier family 12 member 5, anticorps solute carrier family 12, member 5, anticorps SLC12A5, anticorps Slc12a5
- Sujet
- K-Cl cotransporters are proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential.
- Poids moléculaire
- 123 kDa (MW of target protein)
-