KLHL31 anticorps
-
- Antigène Voir toutes KLHL31 Anticorps
- KLHL31 (Kelch-Like 31 (KLHL31))
-
Reactivité
- Souris, Humain, Chien, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLHL31 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
- Top Product
- Discover our top product KLHL31 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLHL31 Blocking Peptide, catalog no. 33R-9231, is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLHL31 (Kelch-Like 31 (KLHL31))
- Autre désignation
- KLHL31 (KLHL31 Produits)
- Synonymes
- anticorps 9830147P19Rik, anticorps D930047P17Rik, anticorps Kbtbd1, anticorps fb95e08, anticorps kbtbd1, anticorps klhl, anticorps wu:fa31h10, anticorps wu:fb95e08, anticorps BKLHD6, anticorps KBTBD1, anticorps KLHL, anticorps bA345L23.2, anticorps RGD1560540, anticorps kelch-like 31, anticorps kelch-like family member 31, anticorps kelch like family member 31, anticorps Klhl31, anticorps klhl31, anticorps KLHL31
- Sujet
- KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)
- Poids moléculaire
- 70 kDa (MW of target protein)
-