LAPTM4B anticorps (Middle Region)

N° du produit ABIN634891

Détail du produit anti-LAPTM4B anticorps

Antigène: LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAPTM4B est non-conjugé

Application: Western Blotting (WB)

Specificité: LAPTM4 B antibody was raised against the middle region of LAPTM4

Purification: Affinity purified

Immunogène: LAPTM4 B antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAPTM4B

Antigène: LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))

Autre désignation: LAPTM4B (LAPTM4B Produits)

Synonymes: anticorps LAPTM4beta, anticorps LC27, anticorps C330023P13Rik, anticorps lysosomal protein transmembrane 4 beta, anticorps lysosomal-associated protein transmembrane 4B, anticorps LAPTM4B, anticorps Laptm4b

Sujet: LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.

Poids moléculaire: 35 kDa (MW of target protein)