NDUFB5 anticorps

N° du produit ABIN634974

Détail du produit anti-NDUFB5 anticorps

Antigène: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDUFB5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NDUFB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDUFB5 Blocking Peptide, catalog no. 33R-4521, is also available for use as a blocking control in assays to test for specificity of this NDUFB5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDUFB5

Antigène: NDUFB5 (NADH Dehydrogenase (Ubiquinone) 1 beta Subcomplex, 5, 16kDa (NDUFB5))

Autre désignation: NDUFB5 (NDUFB5 Produits)

Synonymes: anticorps hm:zeh0024, anticorps zgc:123331, anticorps 0610007D05Rik, anticorps AU015782, anticorps SGDH, anticorps CISGDH, anticorps NADH:ubiquinone oxidoreductase subunit B5, anticorps NADH:ubiquinone oxidoreductase subunit B5 L homeolog, anticorps NADH dehydrogenase (ubiquinone) 1 beta subcomplex 5, anticorps NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, anticorps NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, anticorps Ndufb5, anticorps ndufb5.L, anticorps NDUFB5, anticorps ndufb5

Sujet: NDUFB5 is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Poids moléculaire: 17 kDa (MW of target protein)