MOGAT2 anticorps (Middle Region)
-
- Antigène Voir toutes MOGAT2 Anticorps
- MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MOGAT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MOGAT2 antibody was raised against the middle region of MOGAT2
- Purification
- Affinity purified
- Immunogène
- MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN
- Top Product
- Discover our top product MOGAT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MOGAT2 Blocking Peptide, catalog no. 33R-5142, is also available for use as a blocking control in assays to test for specificity of this MOGAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))
- Autre désignation
- MOGAT2 (MOGAT2 Produits)
- Synonymes
- anticorps mogat2, anticorps DGAT2L5, anticorps MGAT2, anticorps Mgat1l, anticorps wu:fb94h05, anticorps zgc:101667, anticorps dgat2l5, anticorps mgat2, anticorps mogat2-b, anticorps monoacylglycerol O-acyltransferase 2, gene 1, anticorps monoacylglycerol O-acyltransferase 2, anticorps monoacylglycerol O-acyltransferase 2, gene 1 L homeolog, anticorps mogat2.1, anticorps MOGAT2, anticorps Mogat2, anticorps mogat2, anticorps mogat2.1.L
- Sujet
- Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.
- Poids moléculaire
- 38 kDa (MW of target protein)
-