MOGAT2 anticorps (Middle Region)

N° du produit ABIN634991

Détail du produit anti-MOGAT2 anticorps

Antigène: MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MOGAT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MOGAT2 antibody was raised against the middle region of MOGAT2

Purification: Affinity purified

Immunogène: MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MOGAT2 Blocking Peptide, catalog no. 33R-5142, is also available for use as a blocking control in assays to test for specificity of this MOGAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOGAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MOGAT2

Antigène: MOGAT2 (Monoacylglycerol O-Acyltransferase 2 (MOGAT2))

Autre désignation: MOGAT2 (MOGAT2 Produits)

Synonymes: anticorps mogat2, anticorps DGAT2L5, anticorps MGAT2, anticorps Mgat1l, anticorps wu:fb94h05, anticorps zgc:101667, anticorps dgat2l5, anticorps mgat2, anticorps mogat2-b, anticorps monoacylglycerol O-acyltransferase 2, gene 1, anticorps monoacylglycerol O-acyltransferase 2, anticorps monoacylglycerol O-acyltransferase 2, gene 1 L homeolog, anticorps mogat2.1, anticorps MOGAT2, anticorps Mogat2, anticorps mogat2, anticorps mogat2.1.L

Sujet: Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.

Poids moléculaire: 38 kDa (MW of target protein)