SLC32A1 anticorps

N° du produit ABIN635012

Détail du produit anti-SLC32A1 anticorps

Antigène: SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC32A1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC32 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC32A1 Blocking Peptide, catalog no. 33R-3196, is also available for use as a blocking control in assays to test for specificity of this SLC32A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC32A1

Antigène: SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))

Autre désignation: SLC32A1 (SLC32A1 Produits)

Synonymes: anticorps VGAT, anticorps VIAAT, anticorps vGAT, anticorps Ci-vGAT, anticorps slc32a1, anticorps viaat, anticorps MGC68938, anticorps vgat, anticorps xVIAAT, anticorps R75019, anticorps Viaat, anticorps CG8394, anticorps CG8394.2, anticorps Dmel\\CG8394, anticorps Vgat, anticorps zgc:158324, anticorps solute carrier family 32 member 1, anticorps vesicular GABA transporter, anticorps solute carrier family 32 member 1 S homeolog, anticorps vesicular inhibitory amino acid transporter, anticorps Vesicular inhibitory amino acid transporter, anticorps solute carrier family 32 (GABA vesicular transporter), member 1, anticorps Vesicular GABA Transporter, anticorps SLC32A1, anticorps vgat, anticorps Bm1_20950, anticorps slc32a1.S, anticorps slc32a1, anticorps CpipJ_CPIJ002704, anticorps viaat, anticorps Slc32a1, anticorps VGAT, anticorps Tsp_04599

Sujet: SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Proton Transport