COX10 anticorps (Middle Region)

N° du produit ABIN635052

Détail du produit anti-COX10 anticorps

Antigène: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COX10 est non-conjugé

Application: Western Blotting (WB)

Specificité: COX10 antibody was raised against the middle region of COX10

Purification: Affinity purified

Immunogène: COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COX10 Blocking Peptide, catalog no. 33R-2170, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COX10

Antigène: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Autre désignation: COX10 (COX10 Produits)

Synonymes: anticorps 2410004F01Rik, anticorps AU042636, anticorps im:7145568, anticorps im:7157205, anticorps wu:fb18a03, anticorps F4I1.50, anticorps F4I1_50, anticorps cytochrome c oxidase 10, anticorps Cox10, anticorps cytochrome c oxidase assembly protein 10, anticorps COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor, anticorps COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor L homeolog, anticorps COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor, anticorps cytochrome c oxidase 10, anticorps protoheme IX farnesyltransferase, mitochondrial, anticorps Cox10, anticorps cox10, anticorps cox10.L, anticorps COX10, anticorps LOC100732273

Sujet: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase.

Poids moléculaire: 49 kDa (MW of target protein)