TRPM2 anticorps (N-Term)

N° du produit ABIN635099

Détail du produit anti-TRPM2 anticorps

Antigène: TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRPM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRPM2 antibody was raised against the N terminal of TRPM2

Purification: Affinity purified

Immunogène: TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRPM2

Antigène: TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))

Autre désignation: TRPM2 (TRPM2 Produits)

Synonymes: anticorps EREG1, anticorps KNP3, anticorps LTRPC2, anticorps NUDT9H, anticorps NUDT9L1, anticorps TRPC7, anticorps Trpm2-predicted, anticorps TRPM2, anticorps si:ch73-263b18.1, anticorps 9830168K16Rik, anticorps C79133, anticorps Trp7, anticorps Trrp7, anticorps transient receptor potential cation channel subfamily M member 2, anticorps transient receptor potential cation channel, subfamily M, member 2, anticorps transient receptor potential cation channel subfamily C member 7, anticorps TRPM2, anticorps Trpm2, anticorps trpm2, anticorps TRPC7

Sujet: The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Poids moléculaire: 171 kDa (MW of target protein)