SSR1 anticorps (Middle Region)
-
- Antigène Voir toutes SSR1 Anticorps
- SSR1 (Signal Sequence Receptor, alpha (SSR1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SSR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SSR1 antibody was raised against the middle region of SSR1
- Purification
- Affinity purified
- Immunogène
- SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY
- Top Product
- Discover our top product SSR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SSR1 Blocking Peptide, catalog no. 33R-3096, is also available for use as a blocking control in assays to test for specificity of this SSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SSR1 (Signal Sequence Receptor, alpha (SSR1))
- Autre désignation
- SSR1 (SSR1 Produits)
- Synonymes
- anticorps cb758, anticorps trapa, anticorps Ssr1, anticorps TRAPA, anticorps 2510001K09Rik, anticorps 6330400D04, anticorps AI159733, anticorps AI452176, anticorps SSR, anticorps signal sequence receptor, alpha, anticorps signal sequence receptor, alpha (translocon-associated protein alpha), anticorps signal sequence receptor subunit 1, anticorps signal sequence receptor, alpha (translocon-associated protein alpha) S homeolog, anticorps ssr1, anticorps SSR1, anticorps Ssr1, anticorps ssr1.S
- Sujet
- The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein encoded by this gene and a 22 kDa glycoprotein.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-