CCDC90A anticorps (Middle Region)

N° du produit ABIN635301

Détail du produit anti-CCDC90A anticorps

Antigène: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC90A est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC90 A antibody was raised against the middle region of CCDC90

Purification: Affinity purified

Immunogène: CCDC90 A antibody was raised using the middle region of CCDC90 corresponding to a region with amino acids ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC90A Blocking Peptide, catalog no. 33R-2548, is also available for use as a blocking control in assays to test for specificity of this CCDC90A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC90 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC90A

Antigène: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Autre désignation: CCDC90A (MCUR1 Produits)

Synonymes: anticorps C6orf79, anticorps CCDC90A, anticorps 6230416A05Rik, anticorps AU015498, anticorps AV136929, anticorps AW554392, anticorps C88263, anticorps Ccdc90a, anticorps RGD1307673, anticorps mitochondrial calcium uniporter regulator 1, anticorps mitochondrial calcium uniporter regulator 1 L homeolog, anticorps MCUR1, anticorps Mcur1, anticorps mcur1.L

Sujet: The function of CCDC90A protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 40 kDa (MW of target protein)