ATP1B4 anticorps
-
- Antigène Voir toutes ATP1B4 Anticorps
- ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP1B4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ATP1 B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
- Top Product
- Discover our top product ATP1B4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP1B4 Blocking Peptide, catalog no. 33R-1078, is also available for use as a blocking control in assays to test for specificity of this ATP1B4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP1B4 (ATPase, Na+/K+ Transporting, beta 4 Polypeptide (ATP1B4))
- Autre désignation
- ATP1B4 (ATP1B4 Produits)
- Synonymes
- anticorps 1110020B02Rik, anticorps Ac2-628, anticorps ATPase, (Na+)/K+ transporting, beta 4 polypeptide, anticorps ATPase Na+/K+ transporting family member beta 4, anticorps ATPase, Na+/K+ transporting, beta 4 polypeptide L homeolog, anticorps Atp1b4, anticorps ATP1B4, anticorps atp1b4.L
- Sujet
- This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Proton Transport
-