SLC11A2 anticorps (N-Term)
-
- Antigène Voir toutes SLC11A2 Anticorps
- SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC11A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC11 A2 antibody was raised against the N terminal Of Slc11 2
- Purification
- Affinity purified
- Immunogène
- SLC11 A2 antibody was raised using the N terminal Of Slc11 2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF
- Top Product
- Discover our top product SLC11A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC11A2 Blocking Peptide, catalog no. 33R-9663, is also available for use as a blocking control in assays to test for specificity of this SLC11A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2))
- Autre désignation
- SLC11A2 (SLC11A2 Produits)
- Synonymes
- anticorps DCT1, anticorps DMT1, anticorps NRAMP2, anticorps Nramp2, anticorps mk, anticorps van, anticorps Dmt1, anticorps ATNRAMP2, anticorps F8G22.4, anticorps F8G22_4, anticorps NRAMP metal ion transporter 2, anticorps dct1, anticorps dmt1, anticorps nramp2, anticorps SLC11A2, anticorps cb426, anticorps fa07b10, anticorps wu:fa07b10, anticorps zgc:136699, anticorps solute carrier family 11 member 2, anticorps solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2, anticorps NRAMP metal ion transporter 2, anticorps manganese transport protein, anticorps metal transporter Nramp2, anticorps solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2, anticorps SLC11A2, anticorps Slc11a2, anticorps NRAMP2, anticorps LOC9327403, anticorps slc11a2
- Sujet
- The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport, Positive Regulation of Endopeptidase Activity
-