SLC16A6 anticorps
-
- Antigène Voir toutes SLC16A6 Anticorps
- SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC16A6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC16 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
- Top Product
- Discover our top product SLC16A6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC16A6 Blocking Peptide, catalog no. 33R-4049, is also available for use as a blocking control in assays to test for specificity of this SLC16A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC16A6 (Solute Carrier Family 16 (Monocarboxylic Acid Transporters), Member 6 (SLC16A6))
- Autre désignation
- SLC16A6 (SLC16A6 Produits)
- Synonymes
- anticorps MGC53009, anticorps solute carrier family 16 member 6 L homeolog, anticorps solute carrier family 16 member 6, anticorps slc16a6.L, anticorps SLC16A6
- Sujet
- SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
- Poids moléculaire
- 57 kDa (MW of target protein)
-