ATP6V0A1 anticorps (N-Term)

N° du produit ABIN635431

Détail du produit anti-ATP6V0A1 anticorps

Antigène: ATP6V0A1 (ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V0A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 1 antibody was raised against the N terminal of ATP6 6 1

Purification: Affinity purified

Immunogène: ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V0A1 Blocking Peptide, catalog no. 33R-7853, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V0A1

Antigène: ATP6V0A1 (ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1))

Autre désignation: ATP6V0A1 (ATP6V0A1 Produits)

Synonymes: anticorps ATP6N1, anticorps ATP6N1A, anticorps Stv1, anticorps VPP1, anticorps Vph1, anticorps a1, anticorps AA959968, anticorps ATP6a1, anticorps Atp6n1, anticorps Atp6n1a, anticorps Atpv0a1, anticorps Vpp-1, anticorps Vpp1, anticorps A1, anticorps wu:fj37e01, anticorps zgc:112214, anticorps atp6v0a1, anticorps wu:fc25b09, anticorps zgc:76965, anticorps ATPase H+ transporting V0 subunit a1, anticorps ATPase, H+ transporting, lysosomal V0 subunit A1, anticorps si:ch73-173p19.2, anticorps ATPase, H+ transporting, lysosomal V0 subunit a1 L homeolog, anticorps ATPase, H+ transporting, lysosomal V0 subunit a1b, anticorps ATPase, H+ transporting, lysosomal V0 subunit a1a, anticorps ATP6V0A1, anticorps Atp6v0a1, anticorps si:ch73-173p19.2, anticorps atp6v0a1.L, anticorps atp6v0a1b, anticorps atp6v0a1a

Sujet: ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles.

Poids moléculaire: 96 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport