TMEM38B anticorps (C-Term)

N° du produit ABIN635460

Détail du produit anti-TMEM38B anticorps

Antigène: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM38B est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM38 B antibody was raised against the C terminal of TMEM38

Purification: Affinity purified

Immunogène: TMEM38 B antibody was raised using the C terminal of TMEM38 corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM38B Blocking Peptide, catalog no. 33R-9980, is also available for use as a blocking control in assays to test for specificity of this TMEM38B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM38B

Antigène: TMEM38B (Transmembrane Protein 38B (TMEM38B))

Autre désignation: TMEM38B (TMEM38B Produits)

Synonymes: anticorps zgc:55815, anticorps tricb, anticorps tric-b, anticorps MGC83592, anticorps DKFZp469C0220, anticorps C9orf87, anticorps D4Ertd89e, anticorps OI14, anticorps TRIC-B, anticorps TRICB, anticorps bA219P18.1, anticorps 1600017F22Rik, anticorps AA437809, anticorps AV051057, anticorps mg33b, anticorps RGD1305703, anticorps transmembrane protein 38B, anticorps transmembrane protein 38B L homeolog, anticorps tmem38b, anticorps TMEM38B, anticorps tmem38b.L, anticorps Tmem38b

Sujet: TMEM38B is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

Poids moléculaire: 32 kDa (MW of target protein)