KIRREL anticorps

N° du produit ABIN635461

Détail du produit anti-KIRREL anticorps

Antigène: KIRREL (NEPH1) (Kin of IRRE Like 1 (NEPH1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIRREL est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIRREL Blocking Peptide, catalog no. 33R-2959, is also available for use as a blocking control in assays to test for specificity of this KIRREL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIRREL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIRREL

Antigène: KIRREL (NEPH1) (Kin of IRRE Like 1 (NEPH1))

Autre désignation: KIRREL (NEPH1 Produits)

Synonymes: anticorps NEPH1, anticorps 6720469N11Rik, anticorps Kirrel1, anticorps Neph1, anticorps nephrin related, anticorps kirre like nephrin family adhesion molecule 1, anticorps kin of IRRE like (Drosophila), anticorps Smp_104390, anticorps Smp_140170, anticorps KIRREL1, anticorps Kirrel, anticorps Kirrel1

Sujet: KIRREL (NEPH1) is a member of the nephrin-like protein family, which includes NEPH2 and NEPH3. The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization