PON3 anticorps (Middle Region)
-
- Antigène Voir toutes PON3 Anticorps
- PON3 (Paraoxonase 3 (PON3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PON3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PON3 antibody was raised against the middle region of PON3
- Purification
- Affinity purified
- Immunogène
- PON3 antibody was raised using the middle region of PON3 corresponding to a region with amino acids FKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSF
- Top Product
- Discover our top product PON3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PON3 Blocking Peptide, catalog no. 33R-2947, is also available for use as a blocking control in assays to test for specificity of this PON3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PON3 (Paraoxonase 3 (PON3))
- Autre désignation
- PON3 (PON3 Produits)
- Synonymes
- anticorps 2810004E20, anticorps AI786302, anticorps paraoxonase 3, anticorps PON3, anticorps Pon3
- Sujet
- This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL).
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-