SLC17A2 anticorps
-
- Antigène Voir toutes SLC17A2 Anticorps
- SLC17A2 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC17A2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- SLC17 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF
- Top Product
- Discover our top product SLC17A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC17A2 Blocking Peptide, catalog no. 33R-9612, is also available for use as a blocking control in assays to test for specificity of this SLC17A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC17A2 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2))
- Autre désignation
- SLC17A2 (SLC17A2 Produits)
- Synonymes
- anticorps NPT3, anticorps C730032N17Rik, anticorps SLC34A1, anticorps solute carrier family 17 member 2, anticorps solute carrier family 17 (sodium phosphate), member 2, anticorps solute carrier family 17, member 2, anticorps SLC17A2, anticorps Slc17a2
- Sujet
- SLC17A2 is a member of the solute carrier family.
- Poids moléculaire
- 48 kDa (MW of target protein)
-