MTUS1 anticorps (Middle Region)
-
- Antigène Voir toutes MTUS1 Anticorps
- MTUS1 (Microtubule Associated Tumor Suppressor 1 (MTUS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTUS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MTUS1 antibody was raised against the middle region of MTUS1
- Purification
- Affinity purified
- Immunogène
- MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
- Top Product
- Discover our top product MTUS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MTUS1 Blocking Peptide, catalog no. 33R-4631, is also available for use as a blocking control in assays to test for specificity of this MTUS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTUS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTUS1 (Microtubule Associated Tumor Suppressor 1 (MTUS1))
- Autre désignation
- MTUS1 (MTUS1 Produits)
- Synonymes
- anticorps ATBP, anticorps ATIP, anticorps ICIS, anticorps MP44, anticorps MTSG1, anticorps AI481402, anticorps ATBP135, anticorps Atip1, anticorps B430010I23Rik, anticorps B430305I03Rik, anticorps C85752, anticorps Cctsg1-440, anticorps MD44, anticorps mKIAA1288, anticorps ATIP4, anticorps Atip3b, anticorps Mtsg1, anticorps fbx27, anticorps fa17d11, anticorps wu:fa17d11, anticorps wu:fi18f08, anticorps zgc:154168, anticorps microtubule associated scaffold protein 1, anticorps mitochondrial tumor suppressor 1, anticorps microtubule associated scaffold protein 1 L homeolog, anticorps microtubule associated tumor suppressor 1, anticorps microtubule associated tumor suppressor 1a, anticorps MTUS1, anticorps Mtus1, anticorps mtus1.L, anticorps mtus1a
- Sujet
- MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
- Poids moléculaire
- 141 kDa (MW of target protein)
-