GPR161 anticorps (Middle Region)
-
- Antigène Voir toutes GPR161 Anticorps
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPR161 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- GPR161 antibody was raised against the middle region of GPR161
- Purification
- Affinity purified
- Immunogène
- GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
- Top Product
- Discover our top product GPR161 Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPR161 Blocking Peptide, catalog no. 33R-2995, is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPR161 (G Protein-Coupled Receptor 161 (GPR161))
- Autre désignation
- GPR161 (GPR161 Produits)
- Synonymes
- anticorps RE2, anticorps Gm208, anticorps Gm208Gpr, anticorps vl, anticorps RGD1563245, anticorps si:bz20i5.4, anticorps si:rp71-20i5.4, anticorps G protein-coupled receptor 161, anticorps GPR161, anticorps Gpr161, anticorps gpr161
- Sujet
- GPR161 is Orphan receptor.
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-