GPR161 anticorps (Middle Region)

N° du produit ABIN635640

Cet anticorps anti-GPR161 Polyclonal Lapin (ABIN635640) détecte spécifiquement GPR161 dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour GPR161 anticorps (Middle Region) (ABIN635640)

Antigène: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPR161 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GPR161 anticorps

Épitope: Middle Region

Specificité: GPR161 antibody was raised against the middle region of GPR161

Purification: Affinity purified

Immunogène: GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

Information d'application

Indications d'application: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPR161 Blocking Peptide, (ABIN938381), is also available for use as a blocking control in assays to test for specificity of this GPR161 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR161 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPR161

Antigène: GPR161 (G Protein-Coupled Receptor 161 (GPR161))

Autre désignation: GPR161

Sujet: GPR161 is Orphan receptor.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: cAMP Metabolic Process