SLC39A5 anticorps
-
- Antigène Voir toutes SLC39A5 Anticorps
- SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC39A5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogène
- SLC39 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG
- Top Product
- Discover our top product SLC39A5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC39A5 Blocking Peptide, catalog no. 33R-6078, is also available for use as a blocking control in assays to test for specificity of this SLC39A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC39A5 (Solute Carrier Family 39 (Metal Ion Transporter), Member 5 (SLC39A5))
- Autre désignation
- SLC39A5 (SLC39A5 Produits)
- Synonymes
- anticorps 1810013D05Rik, anticorps 2010205A06Rik, anticorps Zip5, anticorps LZT-Hs7, anticorps ZIP5, anticorps solute carrier family 39 member 5, anticorps solute carrier family 39 (metal ion transporter), member 5, anticorps SLC39A5, anticorps Slc39a5
- Sujet
- Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-