CHST1 anticorps

N° du produit ABIN635810

Détail du produit anti-CHST1 anticorps

Antigène: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHST1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHST1 Blocking Peptide, catalog no. 33R-10227, is also available for use as a blocking control in assays to test for specificity of this CHST1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHST1

Antigène: CHST1 (Carbohydrate (Keratan Sulfate Gal-6) Sulfotransferase 1 (CHST1))

Autre désignation: CHST1 (CHST1 Produits)

Synonymes: anticorps C6ST, anticorps GST-1, anticorps KS6ST, anticorps KSGal6ST, anticorps KSST, anticorps sulfo1, anticorps 2610008E20Rik, anticorps AW125896, anticorps Gst1, anticorps KSGAL6ST, anticorps carbohydrate sulfotransferase 1, anticorps carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, anticorps CHST1, anticorps Chst1

Sujet: CHST1 catalyzes the transfer of sulfate to position 6 of galactose (Gal) residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process