SLC27A2 anticorps
-
- Antigène Voir toutes SLC27A2 Anticorps
- SLC27A2 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC27A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC27 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
- Top Product
- Discover our top product SLC27A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC27A2 Blocking Peptide, catalog no. 33R-5137, is also available for use as a blocking control in assays to test for specificity of this SLC27A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC27A2 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 2 (SLC27A2))
- Autre désignation
- SLC27A2 (SLC27A2 Produits)
- Synonymes
- anticorps vlcs, anticorps fatp2, anticorps vlacs, anticorps acsvl1, anticorps facvl1, anticorps im:7139614, anticorps slc27a2, anticorps wu:fb99g05, anticorps zgc:112376, anticorps ACSVL1, anticorps FACVL1, anticorps HsT17226, anticorps hFACVL1, anticorps FATP2, anticorps VLCS, anticorps Vlac, anticorps Vlacs, anticorps VLACS, anticorps solute carrier family 27 (fatty acid transporter), member 2 L homeolog, anticorps solute carrier family 27 member 2, anticorps solute carrier family 27 (fatty acid transporter), member 2a, anticorps solute carrier family 27 (fatty acid transporter), member 2, anticorps slc27a2.L, anticorps SLC27A2, anticorps slc27a2a, anticorps slc27a2, anticorps Slc27a2
- Sujet
- SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.
- Poids moléculaire
- 70 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process, SARS-CoV-2 Protein Interactome
-