FZD5 anticorps

N° du produit ABIN635844

Détail du produit anti-FZD5 anticorps

Antigène: FZD5 (Frizzled Family Receptor 5 (FZD5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FZD5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZD5 Blocking Peptide, catalog no. 33R-8742, is also available for use as a blocking control in assays to test for specificity of this FZD5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZD5

Antigène: FZD5 (Frizzled Family Receptor 5 (FZD5))

Autre désignation: FZD5 (FZD5 Produits)

Synonymes: anticorps C2orf31, anticorps HFZ5, anticorps 5330434N09Rik, anticorps AI427138, anticorps Fz-5, anticorps Fz5, anticorps mFz5, anticorps Xfz5, anticorps frizzled5, anticorps frizzled5a, anticorps fz5, anticorps fzd5-A, anticorps fz2, anticorps fz8c, anticorps fzd8c, anticorps zg02, anticorps frizzled class receptor 5, anticorps frizzled class receptor 5 S homeolog, anticorps FZD5, anticorps Fzd5, anticorps fzd5.S, anticorps fzd5

Sujet: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Signalisation WNT