B4GALT3 anticorps (Middle Region)

N° du produit ABIN635885

Détail du produit anti-B4GALT3 anticorps

Antigène: B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B4GALT3 est non-conjugé

Application: Western Blotting (WB)

Specificité: B4 GALT3 antibody was raised against the middle region of B4 ALT3

Purification: Affinity purified

Immunogène: B4 GALT3 antibody was raised using the middle region of B4 ALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B4GALT3 Blocking Peptide, catalog no. 33R-6588, is also available for use as a blocking control in assays to test for specificity of this B4GALT3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B4GALT3

Antigène: B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))

Autre désignation: B4GALT3 (B4GALT3 Produits)

Synonymes: anticorps beta4Gal-T3, anticorps 9530061M23Rik, anticorps AA104562, anticorps AW125175, anticorps ESTM26, anticorps ESTM6, anticorps R74981, anticorps b4Gal-T3, anticorps beta-1,4-galactosyltransferase 3, anticorps UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog, anticorps UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3, anticorps B4GALT3, anticorps b4galt3.S, anticorps B4galt3

Sujet: This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process