PTPRE anticorps (Middle Region)

N° du produit ABIN635886

Détail du produit anti-PTPRE anticorps

Antigène: PTPRE (Protein tyrosine Phosphatase, Receptor Type, E (PTPRE))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTPRE est non-conjugé

Application: Western Blotting (WB)

Specificité: PTPRE antibody was raised against the middle region of PTPRE

Purification: Affinity purified

Immunogène: PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTPRE Blocking Peptide, catalog no. 33R-9603, is also available for use as a blocking control in assays to test for specificity of this PTPRE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTPRE

Antigène: PTPRE (Protein tyrosine Phosphatase, Receptor Type, E (PTPRE))

Autre désignation: PTPRE (PTPRE Produits)

Synonymes: anticorps ptpra, anticorps HPTPE, anticorps PTPE, anticorps R-PTP-EPSILON, anticorps PTPe, anticorps PTPepsilon, anticorps RPTPepsilon, anticorps protein tyrosine phosphatase, receptor type E L homeolog, anticorps protein tyrosine phosphatase, receptor type E, anticorps protein tyrosine phosphatase, receptor type, E, anticorps ptpre.L, anticorps PTPRE, anticorps Ptpre

Sujet: PTPRE is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Two alternatively spliced transcript variants of this gene have been reported, one of which encodes a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains.

Poids moléculaire: 81 kDa (MW of target protein)