RNF43 anticorps (Middle Region)

N° du produit ABIN635909

Détail du produit anti-RNF43 anticorps

Antigène: RNF43 (Ring Finger Protein 43 (RNF43))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF43 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF43 antibody was raised against the middle region of RNF43

Purification: Affinity purified

Immunogène: RNF43 antibody was raised using the middle region of RNF43 corresponding to a region with amino acids DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF43 Blocking Peptide, catalog no. 33R-1926, is also available for use as a blocking control in assays to test for specificity of this RNF43 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF43

Antigène: RNF43 (Ring Finger Protein 43 (RNF43))

Autre désignation: RNF43 (RNF43 Produits)

Synonymes: anticorps RNF124, anticorps URCC, anticorps 4732452J19Rik, anticorps RGD1305204, anticorps ring finger protein 43, anticorps RNF43, anticorps Rnf43

Sujet: RNF43 is a HAP95 (AKAP8L) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Signalisation WNT