ZMPSTE24 anticorps

N° du produit ABIN635915

Détail du produit anti-ZMPSTE24 anticorps

Antigène: ZMPSTE24 (Zmpste24) (Zinc Metalloproteinase, Ste24 (Zmpste24))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZMPSTE24 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZMPSTE24 Blocking Peptide, catalog no. 33R-5572, is also available for use as a blocking control in assays to test for specificity of this ZMPSTE24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZMPSTE24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZMPSTE24

Antigène: ZMPSTE24 (Zmpste24) (Zinc Metalloproteinase, Ste24 (Zmpste24))

Autre désignation: ZMPSTE24 (Zmpste24 Produits)

Synonymes: anticorps DDBDRAFT_0189115, anticorps DDBDRAFT_0237846, anticorps DDB_0189115, anticorps DDB_0237846, anticorps F2N1.21, anticorps F2N1_21, anticorps STE24, anticorps FACE-1, anticorps FACE1, anticorps HGPS, anticorps PRO1, anticorps Ste24p, anticorps A530043O15Rik, anticorps D030046F19, anticorps Face-1, anticorps MADB, anticorps fi45a02, anticorps wu:fi45a02, anticorps zgc:55655, anticorps zinc metallopeptidase STE24, anticorps zinc metallopeptidase STE24 L homeolog, anticorps CAAX prenyl protease, anticorps Peptidase family M48 family protein, anticorps zinc metallopeptidase, STE24, anticorps zinc metallopeptidase, STE24 homolog, anticorps ZMPSTE24, anticorps zmpste24.L, anticorps zmpste24, anticorps ATSTE24, anticorps Zmpste24

Sujet: ZMPSTE24 is a member of the peptidase M48A family. This protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in ZMPSTE24 gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.

Poids moléculaire: 55 kDa (MW of target protein)