DNAJB9 anticorps
-
- Antigène Voir toutes DNAJB9 Anticorps
- DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DNAJB9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DNAJB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA
- Top Product
- Discover our top product DNAJB9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNAJB9 Blocking Peptide, catalog no. 33R-5786, is also available for use as a blocking control in assays to test for specificity of this DNAJB9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))
- Autre désignation
- DNAJB9 (DNAJB9 Produits)
- Synonymes
- anticorps ERdj4, anticorps MDG-1, anticorps MDG1, anticorps MST049, anticorps MSTP049, anticorps AA408011, anticorps AA673251, anticorps AA673481, anticorps AW556981, anticorps Mdg1, anticorps mDj7, anticorps DnaJ heat shock protein family (Hsp40) member B9, anticorps DNAJB9, anticorps Dnajb9
- Sujet
- DNAJB9 acts as a co-chaperone with an Hsp70 protein.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-