DNAJC1 anticorps
-
- Antigène Voir toutes DNAJC1 Anticorps
- DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DNAJC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT
- Top Product
- Discover our top product DNAJC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNAJC1 Blocking Peptide, catalog no. 33R-7786, is also available for use as a blocking control in assays to test for specificity of this DNAJC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))
- Autre désignation
- DNAJC1 (DNAJC1 Produits)
- Synonymes
- anticorps dnajc1l, anticorps zgc:152779, anticorps DNAJL1, anticorps ERdj1, anticorps HTJ1, anticorps MTJ1, anticorps 4733401K02Rik, anticorps AA960110, anticorps D230036H06Rik, anticorps Dnajl1, anticorps ERj1p, anticorps DnaJ heat shock protein family (Hsp40) member C1, anticorps DnaJ (Hsp40) homolog, subfamily C, member 1, anticorps DnaJ heat shock protein family (Hsp40) member C1 S homeolog, anticorps dnajc1, anticorps DNAJC1, anticorps Dnajc1, anticorps dnajc1.S
- Sujet
- DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.
- Poids moléculaire
- 64 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-