DNAJC1 anticorps

N° du produit ABIN636008

Détail du produit anti-DNAJC1 anticorps

Antigène: DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DNAJC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJC1 Blocking Peptide, catalog no. 33R-2528, is also available for use as a blocking control in assays to test for specificity of this DNAJC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJC1

Antigène: DNAJC1 (DnaJ (Hsp40) Homolog, Subfamily C, Member 1 (DNAJC1))

Autre désignation: DNAJC1 (DNAJC1 Produits)

Synonymes: anticorps dnajc1l, anticorps zgc:152779, anticorps DNAJL1, anticorps ERdj1, anticorps HTJ1, anticorps MTJ1, anticorps 4733401K02Rik, anticorps AA960110, anticorps D230036H06Rik, anticorps Dnajl1, anticorps ERj1p, anticorps DnaJ heat shock protein family (Hsp40) member C1, anticorps DnaJ (Hsp40) homolog, subfamily C, member 1, anticorps DnaJ heat shock protein family (Hsp40) member C1 S homeolog, anticorps dnajc1, anticorps DNAJC1, anticorps Dnajc1, anticorps dnajc1.S

Sujet: DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Chromatin Binding