ACE2 anticorps

N° du produit ABIN636042

Détail du produit anti-ACE2 anticorps

Antigène: ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACE2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACE2 Blocking Peptide, catalog no. 33R-3121, is also available for use as a blocking control in assays to test for specificity of this ACE2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACE2

Antigène: ACE2 (Angiotensin I Converting Enzyme 2 (ACE2))

Autre désignation: ACE2 (ACE2 Produits)

Synonymes: anticorps ACE1, anticorps CD143, anticorps DCP, anticorps DCP1, anticorps ICH, anticorps MVCD3, anticorps ACEH, anticorps 2010305L05Rik, anticorps zgc:92514, anticorps angiotensin I converting enzyme, anticorps angiotensin I converting enzyme 2, anticorps angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, anticorps ACE, anticorps ACE2, anticorps Ace2, anticorps ace2

Sujet: ACE2 belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this geneuggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour