CYP2E1 anticorps (C-Term)

N° du produit ABIN636072

Détail du produit anti-CYP2E1 anticorps

Antigène: CYP2E1 (Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2E1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP2 E1 antibody was raised against the C terminal of CYP2 1

Purification: Affinity purified

Immunogène: CYP2 E1 antibody was raised using the C terminal of CYP2 1 corresponding to a region with amino acids QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2E1 Blocking Peptide, catalog no. 33R-7522, is also available for use as a blocking control in assays to test for specificity of this CYP2E1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2E1

Antigène: CYP2E1 (Cytochrome P450, Family 2, Subfamily E, Polypeptide 1 (CYP2E1))

Autre désignation: CYP2E1 (CYP2E1 Produits)

Synonymes: anticorps CYP2E1, anticorps CYP2E, anticorps CYPIIE1, anticorps CPE1, anticorps P450-J, anticorps P450C2E, anticorps Cyp2e, anticorps cytochrome P450, family 2, subfamily E, polypeptide 1, anticorps cytochrome P450 2E1, anticorps cytochrome P450 2E1-like, anticorps cytochrome P450 family 2 subfamily E member 1, anticorps cytochrome P450, family 2, subfamily e, polypeptide 1, anticorps CYP2E1, anticorps PTRG_07411, anticorps LOC100342572, anticorps LOC100727914, anticorps LOC101843716, anticorps Cyp2e1

Sujet: CYP2E1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation.

Poids moléculaire: 54 kDa (MW of target protein)