CYP20A1 anticorps (N-Term)

N° du produit ABIN636079

Détail du produit anti-CYP20A1 anticorps

Antigène: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP20A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP20 A1 antibody was raised against the N terminal of CYP20 1

Purification: Affinity purified

Immunogène: CYP20 A1 antibody was raised using the N terminal of CYP20 1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP20A1 Blocking Peptide, catalog no. 33R-4185, is also available for use as a blocking control in assays to test for specificity of this CYP20A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP20A1

Antigène: CYP20A1 (Cytochrome P450, Family 20, Subfamily A, Polypeptide 1 (CYP20A1))

Autre désignation: CYP20A1 (CYP20A1 Produits)

Synonymes: anticorps CYP-M, anticorps A930011N14Rik, anticorps Cypm, anticorps wu:fa10c06, anticorps zgc:63986, anticorps cyp-m, anticorps cytochrome P450 family 20 subfamily A member 1, anticorps cytochrome P450, family 20, subfamily a, polypeptide 1, anticorps cytochrome P450, family 20, subfamily A, polypeptide 1, anticorps cytochrome P450 family 20 subfamily A member 1 L homeolog, anticorps CYP20A1, anticorps Cyp20a1, anticorps cyp20a1, anticorps cyp20a1.L

Sujet: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Poids moléculaire: 52 kDa (MW of target protein)