FZD10 anticorps

N° du produit ABIN6755877

Détail du produit anti-FZD10 anticorps

Antigène: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reactivité: Humain, Porc

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD10 est non-conjugé

Application: Immunofluorescence (IF)

Specificité: Human FZD10 / Frizzled 10

Purification: Immunoaffinity purified

Immunogène: The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH. Percent identity by BLAST analysis: Pig, Human (100%), Dog, Horse, Mouse, Bovine (92%).

Type of Immunogen: Synthetic peptide

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from PBS, 2 % sucrose.

Conseil sur la manipulation: Avoid freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur FZD10

Antigène: FZD10 (Frizzled Family Receptor 10 (FZD10))

Autre désignation: FZD10 / Frizzled 10 (FZD10 Produits)

Synonymes: anticorps CD350, anticorps FZ-10, anticorps Fz10, anticorps FzE7, anticorps hFz10, anticorps cFz-10, anticorps Fz-10, anticorps Xfr9, anticorps Xfz10, anticorps frizzled-10, anticorps frizzled10, anticorps fz10, anticorps fze7, anticorps hfz10, anticorps fk48e04, anticorps fz4, anticorps fzb, anticorps wu:fk48e04, anticorps zg04, anticorps Xfz10A, anticorps fzd10a, anticorps Xfz10B, anticorps Xfz9, anticorps fzd10b, anticorps fzd9, anticorps frizzled class receptor 10, anticorps frizzled class receptor 10 L homeolog, anticorps frizzled class receptor 10 S homeolog, anticorps FZD10, anticorps fzd10, anticorps Fzd10, anticorps fzd10.L, anticorps fzd10.S

Sujet: Name/Gene ID: FZD10
Subfamily: Frizzled
Family: GPCR

Synonyms: FZD10, CD350 antigen, CD350, FZ-10, Frizzled homolog 10, HFz10, Frizzled 10, Frizzled family receptor 10, Frizzled-10, FzE7, Fz10

ID gène: 11211

Pathways: Signalisation WNT