PTH anticorps (AA 1-38)

N° du produit ABIN600073

Détail du produit anti-PTH anticorps

Antigène: PTH (Parathyroid Hormone (PTH))

Épitope: AA 1-38

Reactivité: Humain, Singe

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp PTH est non-conjugé

Application: Immunohistochemistry (IHC), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificité: Human PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1-86).

Homologie: Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%) Horse (97%) Elephant, Panda, Dog, Pig (94%) Bovine (90%) Hamster, Cat (87%) Rat (84%) Mouse (81%).

Purification: Protein G purified

Immunogène: Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%), Horse (97%), Elephant, Panda, Dog, Pig (94%), Bovine (90%), Hamster, Cat (87%), Rat (84%), Mouse (81%).

Clone: B2-82

Isotype: IgG1

Information d'application

Indications d'application: Approved: ELISA (1 μg/mL), IHC, IHC-Fr, IHC-P, RIA

Usage: Suitable for use in ELISA: 1 μg/mL. Immunohistochemistry: 2 μg/mL. Frozen, paraffin. RIA: 25 ng/mL.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Sterile distilled water

Concentration: Lot specific

Buffer: Lyophilized from in 50 mM Tris,  pH 7.2

Conseil sur la manipulation: Aliquot to Avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Détails sur PTH

Antigène: PTH (Parathyroid Hormone (PTH))

Autre désignation: Parathyroid Hormone / PTH (PTH Produits)

Synonymes: anticorps PTH1, anticorps Pthp, anticorps PTH-(1-84), anticorps Pth1, anticorps Pthr1, anticorps PTH, anticorps parathyroid hormone, anticorps parathyroid hormone S homeolog, anticorps PTH, anticorps Pth, anticorps pth.S

Classe de substances: Hormone

Sujet: Name/Gene ID: PTH
Family: Hormone

Synonyms: PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1

ID gène: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process