CD68 anticorps (AA 27-282)
-
- Antigène Voir toutes CD68 Anticorps
- CD68 (CD68 Molecule (CD68))
-
Épitope
- AA 27-282
-
Reactivité
- Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD68 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Fonction
- Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)
- Specificité
- The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.
- Purification
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
- Immunogène
- Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag
- Isotype
- IgG
- Top Product
- Discover our top product CD68 Anticorps primaire
-
-
- Indications d'application
-
Western blotting: 0.5-2 μg/mL
Immunohistochemistry: 5-20 μg/mL
Immunocytochemistry: 5-20 μg/mL
Optimal working dilutions must be determined by end user.
- Commentaires
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.
- Agent conservateur
- ProClin
- Précaution d'utilisation
- This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
- Date de péremption
- 24 months
-
- Antigène
- CD68 (CD68 Molecule (CD68))
- Autre désignation
- Scavenger Receptor Class D Member 1 (CD68 Produits)
- Synonymes
- anticorps Lamp4, anticorps Scard1, anticorps gp110, anticorps GP110, anticorps LAMP4, anticorps SCARD1, anticorps CD68 molecule, anticorps CD68 antigen, anticorps Cd68 molecule, anticorps CD68, anticorps Cd68
- Sujet
- CD68, GP110, Macrosialin, Macrophage Antigen CD68
-