Tissue factor anticorps (AA 45-154)

N° du produit ABIN947845

Détail du produit anti-Tissue factor anticorps

Antigène: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Épitope: AA 45-154

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Tissue factor est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Mouse monoclonal antibody raised against a partial recombinant F3.

Réactivité croisée: Humain

Immunogène:

immunogen: F3 (AAH11029, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK

Clone: 4G4

Isotype: IgG2a kappa

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: In ascites fluid

Conseil sur la manipulation: Aliquot to avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Références pour anticorps anti-Tissue factor (ABIN947845)

Cugno, Marzano, Lorini, Carbonelli, Tedeschi: "Enhanced tissue factor expression by blood eosinophils from patients with hypereosinophilia: a possible link with thrombosis." dans: PLoS ONE, Vol. 9, Issue 11, pp. e111862, (2014) (PubMed).

Détails sur Tissue factor

Antigène: Tissue factor (F3) (Coagulation Factor III (thromboplastin, Tissue Factor) (F3))

Autre désignation: F3 (F3 Produits)

Synonymes: anticorps CD142, anticorps TF, anticorps TFA, anticorps PRO1557, anticorps PRO2086, anticorps TFQTL1, anticorps f3, anticorps AA409063, anticorps Cf-3, anticorps Cf3, anticorps tf, anticorps zgc:112151, anticorps coagulation factor III, tissue factor, anticorps transferrin, anticorps coagulation factor IIIa, anticorps coagulation factor III, anticorps tissue factor, anticorps coagulation factor IIIb, anticorps coagulation factor III (thromboplastin, tissue factor) S homeolog, anticorps F3, anticorps TF, anticorps f3a, anticorps tf, anticorps f3b, anticorps f3.S

Sujet: Full Gene Name: coagulation factor III (thromboplastin, tissue factor)
Synonyms: CD142,TF,TFA

ID gène: 2152

Pathways: Positive Regulation of Endopeptidase Activity, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling