anti-Humain CDK3 anticorps pour Immunofluorescence

Recommended CDK3 Antibody (fourni par: Connectez-vous pour afficher )

Cyclin-Dependent Kinase 3 (CDK3) Anticorps
  • cyclin dependent kinase 3
  • cyclin-dependent kinase 3
  • CDK3
  • cgd3_1510
  • Chro.30182
Cet anticorp CDK3 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher


N° du produit ABIN4297051
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5566389 FACS ICC IF IHC FITC Rabbit AA 1-305 Connectez-vous pour afficher Polyclonal 0
1 ABIN5566391 FACS ICC IF IHC PE Rabbit AA 1-305 Connectez-vous pour afficher Polyclonal 0
1 ABIN5566387 FACS ICC IF IHC APC Rabbit AA 1-305 Connectez-vous pour afficher Polyclonal 0


Antigène Cyclin-Dependent Kinase 3 (CDK3) Anticorps
Reactivité Humain
(80), (31), (21), (3), (3), (2)
Hôte Lapin
(76), (4)
Conjugué Cet anticorp CDK3 est non-conjugé
(4), (4), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(60), (27), (14), (13), (13), (6), (3), (3), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-CDK3 anticorps

Détail du antigène CDK3 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Isotype IgG
Plasmids, Primers & others

Détail du antigène CDK3

Détail du produit anti-CDK3 anticorps Information d'application Stockage Images Haut de la page
Autre désignation Cdk3 (CDK3 Antibody Extrait)
Sujet Gene Symbol: CDK3
ID gène 1018
Pathways Cycle Cellulaire

Information d'application

Détail du produit anti-CDK3 anticorps Détail du antigène CDK3 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-CDK3 anticorps Détail du antigène CDK3 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-CDK3 anticorps Détail du antigène CDK3 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Cyclin-Dependent Kinase 3 (CDK3) antibody (ABIN4297051) Immunocytochemistry/Immunofluorescence: Cdk3 Antibody [NBP1-86496] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin-Dependent Kinase 3 (CDK3) antibody (ABIN4297051) Immunohistochemistry-Paraffin: Cdk3 Antibody [NBP1-86496] - Staining of human kidney ...
Immunofluorescence (IF) image for anti-Cyclin-Dependent Kinase 3 (CDK3) antibody (ABIN4297051) Immunocytochemistry/Immunofluorescence: Cdk3 Antibody - Immunofluorescent staining o...