anti-Humain CLIP2 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended CLIP2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
CAP-GLY Domain Containing Linker Protein 2 (CLIP2) Anticorps
  • CLIP
  • CLIP-115
  • CYLN2
  • WBSCR3
  • WBSCR4
  • WSCR3
  • WSCR4
  • Cyln2
  • B230327O20
  • Clip1
  • mKIAA0291
  • wbscr4
  • CLIP-2
  • CAP-Gly domain containing linker protein 2
  • CAP-GLY domain containing linker protein 2
  • cartilage intermediate layer protein 2
  • CLIP2
  • Clip2
  • clip2
  • CILP2
Reactivité
Humain
51
30
20
4
1
Hôte
Lapin
45
6
Clonalité
Polyclonal
Conjugué
Cet anticorp CLIP2 est non-conjugé
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
36
23
13
4
3
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4301707
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN1408430 IHC (p) WB HRP Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN1390537 IHC (p) WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN1386507 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal

General

Antigène CAP-GLY Domain Containing Linker Protein 2 (CLIP2) Anticorps
Reactivité Humain
(51), (30), (20), (4), (1)
Hôte Lapin
(45), (6)
Clonalité
Polyclonal
Conjugué Cet anticorp CLIP2 est non-conjugé
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(36), (23), (13), (4), (3), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-CLIP2 anticorps

Détail du antigène CLIP2 Information d'application Stockage References for anti-CLIP2 antibody (ABIN4301707) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA
Isotype IgG

Détail du antigène CLIP2

Détail du produit anti-CLIP2 anticorps Information d'application Stockage References for anti-CLIP2 antibody (ABIN4301707) Images Haut de la page
Antigène
Autre désignation CYLN2 (CLIP2 Antibody Extrait)
Sujet Gene Symbol: CLIP2
ID gène 7461
Domaine de recherche Neurology
Pathways Dynamique des Microtubules

Information d'application

Détail du produit anti-CLIP2 anticorps Détail du antigène CLIP2 Stockage References for anti-CLIP2 antibody (ABIN4301707) Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-CLIP2 anticorps Détail du antigène CLIP2 Information d'application References for anti-CLIP2 antibody (ABIN4301707) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-CLIP2 antibody (ABIN4301707)

Détail du produit anti-CLIP2 anticorps Détail du antigène CLIP2 Information d'application Stockage Images Haut de la page
Produit citée dans:

Selmansberger, Feuchtinger, Zurnadzhy, Michna, Kaiser, Abend, Brenner, Bogdanova, Walch, Unger, Zitzelsberger, Hess: "CLIP2 as radiation biomarker in papillary thyroid carcinoma." dans: Oncogene, Vol. 34, Issue 30, pp. 3917-25, 2015 (Échantillon (espèces): Human). Détails: Immunohistochemistry

Images

Détail du produit anti-CLIP2 anticorps Détail du antigène CLIP2 Information d'application Stockage References for anti-CLIP2 antibody (ABIN4301707) Haut de la page
Supplier Images
Immunohistochemistry (IHC) image for anti-CAP-GLY Domain Containing Linker Protein 2 (CLIP2) antibody (ABIN4301707) Immunohistochemistry: CYLN2 Antibody [NBP1-85569] - Staining of human rectum shows st...
Western Blotting (WB) image for anti-CAP-GLY Domain Containing Linker Protein 2 (CLIP2) antibody (ABIN4301707) Western Blot: CYLN2 Antibody [NBP1-85569] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-CAP-GLY Domain Containing Linker Protein 2 (CLIP2) antibody (ABIN4301707) Immunohistochemistry-Paraffin: CYLN2 Antibody - Staining of human rectum shows stron...